SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_016992m|PACid:19286493 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_016992m|PACid:19286493
Domain Number 1 Region: 110-209
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-23
Family B3 DNA binding domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_016992m|PACid:19286493
Sequence length 301
Sequence
MMMDQGVVVHEKNEARAFMAGVEGVTAKGDKSTRFGSDPIRASGSSLDLVAAVTSAVGAN
INRKKRMARQRRSSSFNLLAFSSPSSSSTSHVSPPLALPAREIDPGRLRFLFQKELKNSD
VSSLRRMILPKKAAEAHLPVLESKEGIFISMEDLDGLHVWTFKYRFWPNNNSRMYVLENT
GDFVNAHGLQLGDFIIVYQDDHNQNYVIQAKKASDQDVYTNLTSDSVNDILLNDYEANRS
GSFYVNHPMAGEDTGMSFIYDTTTFSNDSPLDFLGGSLTSYSRIGQESFGSVENISLDDF
Y
Download sequence
Identical sequences V4TII3
clementine0.9_016992m|PACid:19286493 XP_006446963.1.91645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]