SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_017696m|PACid:19252647 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_017696m|PACid:19252647
Domain Number 1 Region: 180-281
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.22e-24
Family B3 DNA binding domain 0.0059
Further Details:      
 
Domain Number 2 Region: 2-59
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000687
Family B3 DNA binding domain 0.0031
Further Details:      
 
Weak hits

Sequence:  clementine0.9_017696m|PACid:19252647
Domain Number - Region: 143-179
Classification Level Classification E-value
Superfamily HMG-box 0.0778
Family HMG-box 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_017696m|PACid:19252647
Sequence length 287
Sequence
MWFVELKKCNKQLWFDIGWHEFIEHCSIHSGYFLIFKYQGNSNFNVYIFDLAISEIEYPS
LEEPSDSKQCHVPIEKDKEKNSSLRILPPLRAPCPDPFSPATKVLDEGVCYKCNKDSTSG
VKIEYLHIPKDEHNQETAFHCPQDKGIQFKNTSDEVGLRWRAVTTEEKKRTVHAAEMYKS
NNPLFRVILRPSYVYRTLLLHVPTSFARKYLNGIKGYITIIDSNGKQWPVRCIFKNGGAK
FSKGWPEFVWENNLDESDVCVFELIKSNDVTLKATIFRVLEDARPVY
Download sequence
Identical sequences V4UAQ6
XP_006423109.1.91645 clementine0.9_017696m|PACid:19252647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]