SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_020140m|PACid:19274805 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_020140m|PACid:19274805
Domain Number 1 Region: 122-220
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.96e-24
Family B3 DNA binding domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_020140m|PACid:19274805
Sequence length 241
Sequence
MVKAKPSYEECRLKRVEENKKRMEALNLPMLCQALRKKPSIEPSHEKQVKPRTVKKQEDV
VLRRSSRVANKPAPVYNGVTLVRVEIPRRISSKRDLSNRVYASDEARAGAVEKAEKLEAR
LGPEHPTFIKPMLQSHVTGGFWLGLPGYFCRRNLPKRDEAITLIDEDGDEYPTVYLPRKT
GLSGGWKAFAVAHGLVDGDALVFQLIRNTAFKVYIIRVNGSDQMKNLLNSKYQISEPVQS
I
Download sequence
Identical sequences V4V7F6
clementine0.9_020140m|PACid:19274805 XP_006434799.1.91645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]