SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_031190m|PACid:19279885 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_031190m|PACid:19279885
Domain Number 1 Region: 61-180
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000314
Family B3 DNA binding domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_031190m|PACid:19279885
Sequence length 208
Sequence
IALLSDADGVTSKEERNSIEKKLALKKGKKRVDFGPNPPPVLPINFLNKIRHMHGKYIVR
VIQKPLYKSDISKPECRFSIPVKQVQQEFLTKQEKILLDTCDSHKKKASRIEATLIDPSL
TEKKISLRKWETKKKHHMYGSGNSSSSYSSSSYVLMNKWYNIVEENQLKKGDVVQVWAFR
TAAAASASTSSSRLCFALVVLSHPQDRN
Download sequence
Identical sequences clementine0.9_031190m|PACid:19279885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]