SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_031493m|PACid:19269081 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_031493m|PACid:19269081
Domain Number 1 Region: 15-113
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.51e-18
Family B3 DNA binding domain 0.0039
Further Details:      
 
Domain Number 2 Region: 263-356
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000726
Family B3 DNA binding domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_031493m|PACid:19269081
Sequence length 359
Sequence
MAFRRRAEPKMASSMKKTNSLFFQVILAVTIEDKKMKIPQNFVGRFGDELSYVATLTNPK
GYVVRIGITKKEGKIWFDDGWNEFVQYHSIGVGYFVVFQYRKNSKFQVFVFNTTTFEIQY
PSRNMFPPSRQNQATVNSSKSKNGCKMQSKTYRMEELEVNDELDNVNDSIQDIIGTSNSE
GSVHAKVHLSETQCLSVQETDLKIDSTKFKKAKHNLKYELRADSVDQIKSIALLEDMDTY
DCESRMTLEEKQEAINVARFLKPEKPSFLVFLRASNMQLNCVYVPNSFARKYFNGEECVT
IQDSDGRKLAVKVKVSCSKCLLTRWGKFFKKTNVKEGDILFFEMIQMKNILLKVSVFNA
Download sequence
Identical sequences A0A067DTA1 V4S7Q7
clementine0.9_031493m|PACid:19269081 XP_006423232.1.91645 orange1.1g042542m|PACid:18094745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]