SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_031701m|PACid:19265383 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_031701m|PACid:19265383
Domain Number 1 Region: 4-93
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000222
Family B3 DNA binding domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_031701m|PACid:19265383
Sequence length 113
Sequence
MEVYSKILTETDVSTRLAVESNTIDEFFLAFEAGQYSQNLVVEDENGERWPFRLFIRQGP
YRKPTISAGWRCFVMSKQAEVGDQVVFIKERAGAIGSAFRYKIRVSKTTEAIR
Download sequence
Identical sequences A0A2H5QHZ1 V4SAN5
clementine0.9_031701m|PACid:19265383 XP_006431363.1.91645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]