SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_033288m|PACid:19278181 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_033288m|PACid:19278181
Domain Number 1 Region: 106-210
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000051
Family B3 DNA binding domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_033288m|PACid:19278181
Sequence length 222
Sequence
ILKAAEEAADGDESLKMSLVTRIIVQQLVEKQMAQKKKFDNLGFDIYTQKRKRGDKDDEK
EIRKPRKQREKGNKNVNQEESVVADMPESFENRIREENGTDLVLVMQKKITECDLRSNNN
RLSIPPTKVRDDNFLNPKEKGILNAKEGIEVFMIPPSLKHNVPLTLKKWRMGDNYTYNLM
NTWHALVVDDKDNGLELGSEVQLWSFRKNNSDLCFALVKLEG
Download sequence
Identical sequences clementine0.9_033288m|PACid:19278181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]