SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_035978m|PACid:19279025 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_035978m|PACid:19279025
Domain Number 1 Region: 252-366
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.57e-17
Family Ankyrin repeat 0.0015
Further Details:      
 
Domain Number 2 Region: 51-178
Classification Level Classification E-value
Superfamily POZ domain 0.000000000628
Family BTB/POZ domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_035978m|PACid:19279025
Sequence length 555
Sequence
ITENANEKSASLSFASSYSTCWSTNQSTGPEICSDLDNLNLRKQSSNPEEPWLDAEIVVE
GKSVAVNRSILSAHSQFLHRLFNLRNDGSVSEGKPKYLMTDLVPYDRKFGFEAFNEILYY
LYTGMIKESPSEVSTCVHDACVHSTCPPAINYAIELIYASVAFQMTELVSVFQLWLLEVV
EKALVEDVIPTLVAALHCQLNQLRSYWIQRIARSNLDNVCLEKELPDEVSSEIKSLRVKS
NQESEANIAEVNPINAKVVRGIHRALDSGDVELLKLLLDVSNVTLDDAYALHYAAAYCNP
MGFKEVLNMGLADLNLKDARGRTVLHVAARHKEPAVMVALLSKGACASETTSDGQTALAI
STKQGQETNKDRLCIDVLEREMRRNSMSGNLAMSAEVMDDDFQRKLDYMESIVTCVRLFP
SEARVAMEIAGADTTTGLSAFGRKGLSGNLKEVDLNETPSMQAKRCQLRLLTLLKTVETG
QRYFPNCSEVVEKFMFFNPANCSELVDEFLDCDSADASLLEKGTPEVQKLQRACFMKLKV
EMPEAVCKDMAYHHR
Download sequence
Identical sequences clementine0.9_035978m|PACid:19279025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]