SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_028457721.1 from Chloroflexus sp. MS-G

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_028457721.1
Domain Number 1 Region: 1-149
Classification Level Classification E-value
Superfamily Ribosomal protein S7 1.44e-56
Family Ribosomal protein S7 0.00000664
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_028457721.1
Sequence length 157
Comment MULTISPECIES: 30S ribosomal protein S7 [Chloroflexus]
Sequence
MPRRGNVERRPIPPDARYNSVLVQKFINKVMERGKKSLAERIVYQALDLAAARLKKPQME
IFEQAIRNASPSIEVKPKRVGGATYQVPVEVKSDRRYSLAMRWLIMSARARTGKPMVERL
AAELIDAYNNTGATIKRKEDVHRMAEANRAFAHYGRL
Download sequence
Identical sequences WP_028457721.1 WP_028457721.1.42449 WP_028457721.1.54286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]