SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_031457865.1 from Chloroflexus sp. MS-G

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_031457865.1
Domain Number 1 Region: 13-401
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 1.44e-138
Family ArgJ-like 0.000000761
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_031457865.1
Sequence length 405
Comment ornithine acetyltransferase [Chloroflexus sp. MS-G]
Sequence
MITFLADGHATSPRGWRAAVAACGIKYADRDDLALLVSNYPATAAAVFTTNAVKAAPVRY
DMALMAQGTDLRAVVINAGNANACTGADGDAAAVAMAQAVEQALDLPPRSTFVMSTGTIG
VPMPIEKIVRGIAVAARRLSPEYGPAAARAIMTTDTRPKHCAVTVTLSGGQVITIGGMAK
GAGMIHPNMATMLAVVTTDATVPGPVLDQAMRQALEVSFNSISIDGDTSTNDTLLVMANG
ASAAPPITDLDTPDGAAFCAGLTAVCQHLAHAIVRDGEGATRFVTITVRGAVNDTEAKLA
AMTIARSPLVKTALFGADPNWGRVLCAIGYSGATVDPDRVVLSFGGMRVLENGLPLPFDE
QAAHQLLDVAEITIDADLGLGEGKATVWTCDLSYDYVRINAAYRT
Download sequence
Identical sequences 2013970238 WP_031457865.1 2017033053 2010316223 WP_031457865.1.42449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]