SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_031457973.1 from Chloroflexus sp. MS-G

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_031457973.1
Domain Number 1 Region: 5-320
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 9.29e-71
Family DmpA-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_031457973.1
Sequence length 323
Comment peptidase S58 [Chloroflexus sp. MS-G]
Sequence
MNTPSITQVQGVLVGHATNEEALTGVTVVLTPEGAVAGVDVRGGAPGTRETDLLDPVNLV
QQVHAVVLTGGSAFGLAAATGVVSWLYERGYGFDVGLTKVPIVPAAVIFDLGIGRADIWP
DATMGYAACVAAETTVAEGSVGAGTGATVGKVGGMGTAMRGGVGTWSETLANGVTVGALV
VVNAFGDVVDDQGRIVAGARTSDRTLIGTGTLLRGGLSRQSFADSVGQNTTIAVVATDAR
LDKAAATRLAMMAQDGLARAIRPAHSPFDGDTVFALATGVHEAPPLVTLGAVAADVLATA
IVRAVQAATTAAGVPAARDLAGS
Download sequence
Identical sequences WP_031457973.1 2013969725 WP_031457973.1.42449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]