SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_031458927.1 from Chloroflexus sp. MS-G

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_031458927.1
Domain Number - Region: 49-121
Classification Level Classification E-value
Superfamily Prefoldin 0.0191
Family Prefoldin 0.017
Further Details:      
 
Domain Number - Region: 125-198
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0262
Family Apolipoprotein 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_031458927.1
Sequence length 235
Comment hypothetical protein [Chloroflexus sp. MS-G]
Sequence
MTNEANGINSPQEAEELERVRQIILGSSARQPRQAEVDRLREILFGPQMEEYARTFSDLR
RQIEHLTEDVRQLQDRLGEVEKTMQRRFDALDVETRRLNDDLRREIERQRAREALLQQIA
SQSRQHEAAINSLGEGVSELRRVQNHHDLEIRSGRAGLAETRDLLEQRTQSLRRELRNTE
DALRTELRRIADRLDNQKTDRKALASMLIEIATRLETGSTVAGLLDGLSATKDDS
Download sequence
Identical sequences WP_031458927.1 2010227541 WP_031458927.1.42449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]