SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_031458971.1 from Chloroflexus sp. MS-G

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_031458971.1
Domain Number 1 Region: 107-208
Classification Level Classification E-value
Superfamily Siroheme synthase middle domains-like 9.81e-23
Family Siroheme synthase middle domains-like 0.0042
Further Details:      
 
Domain Number 2 Region: 2-111
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 7.88e-19
Family Siroheme synthase N-terminal domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_031458971.1
Sequence length 226
Comment uroporphyrin-III methyltransferase [Chloroflexus sp. MS-G]
Sequence
MYYPVMLDLRGKRVLFIGGGGETDVKVQHLIEAGAWVRLISPYAHPALEPVAQASQLDWQ
RREYRYGDLEGFMLCFVHLPDTRLNAVIAQEARERGIWLNAVDDPQYCDFILPSVHHQGD
LVIAVSTSGVAPALAVRIRERLAQEYGPEYAMYLQLLRAFRTLVRQAYPYSFAERKAAWY
RMVDSSALNLIRAGAYAQAQELLWQTLYNSASTSVVELRTHQQETV
Download sequence
Identical sequences WP_031458971.1 WP_031458971.1.42449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]