SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_031459113.1 from Chloroflexus sp. MS-G

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_031459113.1
Domain Number 1 Region: 117-199,230-392,528-656
Classification Level Classification E-value
Superfamily Subtilisin-like 4.06e-58
Family Subtilases 0.00023
Further Details:      
 
Domain Number 2 Region: 417-517
Classification Level Classification E-value
Superfamily PA domain 0.0000000114
Family PA domain 0.013
Further Details:      
 
Weak hits

Sequence:  WP_031459113.1
Domain Number - Region: 606-757
Classification Level Classification E-value
Superfamily Aerolisin/ETX pore-forming domain 0.0288
Family (Pro)aerolysin, pore-forming lobe 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_031459113.1
Sequence length 1053
Comment peptidase S8 [Chloroflexus sp. MS-G]
Sequence
MRSITKRHLFAMIISIGLTIALVAPSAAQPPRPLPNIEALRLEEPAMLEGRSLVLSPSLI
GASGRQEVVIRLSENPTARVPEGAAQAAQLQRITQQQERVLARLRTIDPTLTELARLRVA
LNAVIVEVDGAALPALARDTEVVRINPVVNYERETQPPMETVPYIGATPEVQAAGYRGKG
VRVAVLDSGIDYTHAAFGGPGTLAAYQAAYGTSPADPRNKTLDGLFPTDRVKGGYDFVGE
VWPNGPLMPDPDPIDCGAPGLSSGTCAGGHGTHVADIIGGEQGVAPEVDLFAVKVCSAVS
SSCSGVAILQGLDWVADPNGDGVTDDRMHIVNMSLGAAYGQNYDDDSAIAVDNLQPLGIL
VVASAGNSADRPYITGTPAGARTALSVAQTAVPSDASYPITVLSTTVYGVAQPWAPIPNT
PVSGTLVYGQALGNALGCTAYSPGSLTGQILLVDRGVCAISIKGSNGAAAGAVAVIVANN
VAGAVPPVFGFGGGTPTVPVLSITQAAGNTLKARTGNTTTIGFDTPFSNAGSVVGTSSRG
PTLGQMTYGNQIMYGQIIKPEIGAPGASISAVAGSGTGVAPFGGTSGAAPMVAGAAALLY
NASNWSLSPWELKARLINTAETNIYNGPPAFLGPALAPITRIGGGEVRINRAIAAQASAW
ELSNGAATISFGLVDATRNPTTLRRTIVVRNYGDTPLTYTITPTFRYSNDAASGAVTPST
SVSTITVPPRSRRTFTLTLRIDPTKLPTWVLNSGTNGGNGAALTDVEYDGYLVLDAAGTT
NDLTMPWHVIPRAAGTVSAPTSVRATTTSPATARLTNTGANPVSVDPFTLIGENPFVTAS
PGAGIQMPPMDLRYVGVRAFSIPGFCPANSPIVQFAVTTHQRITHSNYPVEIDLLFDTDR
DGTPDYVGFTAELSLPSGAFAADGRNAFFVGPLAGPYSAFFFTGHATNSANTVLTMCGSQ
IGVTSLGQQINVDAYTYDNYFTGFELSKIEGMSTVLGAPRFDIDVGSGVVPERGSLNTTI
YRFSAPADVTDSGILLHYSFAPEGREASAIIVR
Download sequence
Identical sequences WP_031459113.1 WP_031459113.1.42449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]