SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_031459781.1 from Chloroflexus sp. MS-G

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_031459781.1
Domain Number 1 Region: 14-397
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 4.84e-112
Family ArgJ-like 0.00000779
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_031459781.1
Sequence length 398
Comment arginine biosynthesis protein ArgJ [Chloroflexus sp. MS-G]
Sequence
MNFTIFEDGHIASPTGFRATGISAGLKEGSKARDLALVYSQYPCRAAAMFTTSVFKAAPV
FLSQAILLRNHDAIRAVLINAGQANAGTGQNGLNDAIECAKITADELEVPRDSVLLMSTG
LIGVPLPMQRMRNGIRRAVSELDSNGGRRAAMAILTTDTRPKERVLRVSLRNGPRYTLAG
MAKGTRMIHPRLATLLALITTDLAISQPLLQRALRQSVDRSFNRLNIDGDCSPNDSVIML
ANGAIDHPPITDSSTWEFGVFQEALDFLCADLANQIVRDAAGSGKVIKVVVQGAADEATA
QAIAHAVARSGSVRAACRRNSSDWGALLAAIGASAVELRPDLLDLRIGTVPVMLRGTPVP
FDPTNLVQTMSGPEVELVIDLNLGLAETTVWTCTWTDG
Download sequence
Identical sequences WP_031459781.1.42449 WP_031459781.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]