SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383789946|ref|YP_005474520.1| from Spirochaeta africana DSM 8902

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383789946|ref|YP_005474520.1|
Domain Number 1 Region: 6-254
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.49e-62
Family Phosphate binding protein-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383789946|ref|YP_005474520.1|
Sequence length 255
Comment periplasmic component of amino acid ABC-type transporter/signal transduction system [Spirochaeta africana DSM 8902]
Sequence
MIHKLMRAIIAVGMAALLAAAFVSCQAEETGRPERLVIATDATWPPMQYVDENREIVGFD
IDLINAIGEAADVEIEVRNTAWDGIFAGLLNRDYDAVISSVTITEDRQRTMDFSTPYLNA
GQVLIVRSETEGVSELADLAGQAVGAQIGTTGFFEVQNTAGIEALSYDEIGLAIEDLANG
QIAGVVADTPIAANYVLQNENYRDQLMIVGEPFTEEYFGIAVRQGNERVLSVINEGLEAV
IAAGLIEELEDKWLR
Download sequence
Identical sequences H9UH20
gi|383789946|ref|YP_005474520.1| WP_014454810.1.76488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]