SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383791399|ref|YP_005475973.1| from Spirochaeta africana DSM 8902

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383791399|ref|YP_005475973.1|
Domain Number 1 Region: 2-202
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.61e-54
Family Phosphate binding protein-like 0.0000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383791399|ref|YP_005475973.1|
Sequence length 206
Comment ATP phosphoribosyltransferase [Spirochaeta africana DSM 8902]
Sequence
MKQLTLALPKGRLTEQVQEHLTARGITVQFDKRKLVAEDPQGILKVLLVKNSDLTTYVHH
GIAGLGVCGDDVMIESGHQLIKLHTFDFGATRMCLAARTGTPAPDGGSVTIATSYIEFAR
QYFQAQGQEVKLIRLNGSVELAPILGLAPYIVDLVETGSTLKANNLEVVQELAPIQVHLV
ANPSYYKLNYQAVDQLVTTIRQGVSA
Download sequence
Identical sequences H9UL73
WP_014456249.1.76488 gi|383791399|ref|YP_005475973.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]