SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000000313 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000000313
Domain Number 1 Region: 17-262
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.04e-26
Family Tryptophan biosynthesis enzymes 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000000313   Gene: ENSGMOG00000000319   Transcript: ENSGMOT00000000332
Sequence length 262
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_2926:725511:728654:1 gene:ENSGMOG00000000319 transcript:ENSGMOT00000000332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFSQLFGRLKSVVIGMIHVQAMPGTPLNKMNISQITYEACKEAEIYLNVGIDGLIIENM
HDIPYSLSVGPEVCASMTAVCTTVRGLCPTLPLGIQILSAANKPAIAVALASGLDFMRAE
GFVFSHVADEGLLNACAGDLLRYRRQIGAEHIQIFTDIKKKHSSHALTSDVSIEETAKAA
EFFLSDGIIVTGIATGAQADPQELKAVALSVNIPVLIGSGVTYDNVDHYMDANAMIIGSH
FKKDGHWANPVDQENVRRFMSK
Download sequence
Identical sequences ENSGMOP00000000313 ENSGMOP00000000313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]