SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000008882 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000008882
Domain Number 1 Region: 246-486
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.01e-58
Family Decarboxylase 0.000000549
Further Details:      
 
Domain Number 2 Region: 14-207
Classification Level Classification E-value
Superfamily PRTase-like 8.52e-43
Family Phosphoribosyltransferases (PRTases) 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000008882   Gene: ENSGMOG00000008301   Transcript: ENSGMOT00000009128
Sequence length 488
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1550:227798:235138:-1 gene:ENSGMOG00000008301 transcript:ENSGMOT00000009128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VYDPAAMENTCIDSLILKLHDVNAVKFGEYKLKSGMMTPIYIDLRVLVSYPSLMNKLSSL
IYQLAQAEQLKFDSVCGVPYTALPLATIICSRNELPMLIRRKEAKDYGTKKMVEGVTRQG
DTCLIIEDTVTTGSSIMETAEVLYKEGLKVTDAIVLMDREQGGVAMLGSEGIKLHPVISM
SQLLSVLQAAGRISPAMAQSVRDFILDNNTFRPKAGNGNLSPLAKKTCKNKSVLSYGARA
KLSDIHPLGSKLLQIMEEKKSNLCVAADVTSCTELLALADTLGPKICLLKTHVDILEDFT
PAFCNALKDLADKHNFLIFEDRKFADIGSTVKHQYEGGVYRISSWAHLVNAHAVPGPGVA
QGLRAAGQALGRACLLIAQMSSQGSLATGEYTQSVLKMAEEQSDFVLGFICGSRITQKPQ
FIHMTPGVQMQAGGDGLGQQYTSPEEVIATKASDVIIVGRGILGASNRPEAAEAYRKAGW
EAYVKRLA
Download sequence
Identical sequences ENSGMOP00000008882 ENSGMOP00000008882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]