SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000009104 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000009104
Domain Number 1 Region: 25-159
Classification Level Classification E-value
Superfamily dUTPase-like 3.53e-44
Family dUTPase-like 0.00000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000009104   Gene: ENSGMOG00000008505   Transcript: ENSGMOT00000009351
Sequence length 175
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_2886:165818:168681:1 gene:ENSGMOG00000008505 transcript:ENSGMOT00000009351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTNASDVSPLKRTRTETHSEDDPLVLKFAKLSELATTPTRGSPRAAGYDLYSAYEYTIEP
MDKALVRTDLQIAVPHGYYGRVAPRSGLAVKNFIDVGAGVVDEDYRGNVGVVLFNFAKTP
FVVRKGDRIAQLICEKICYPELVTLDETQRGAGGFGSTGANSLVSSLPPRWSRKE
Download sequence
Identical sequences ENSGMOP00000009104 ENSGMOP00000009104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]