SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010385 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010385
Domain Number 1 Region: 2-172
Classification Level Classification E-value
Superfamily BRCA2 helical domain 5.75e-60
Family BRCA2 helical domain 0.00000191
Further Details:      
 
Domain Number 2 Region: 326-447
Classification Level Classification E-value
Superfamily BRCA2 tower domain 7.06e-36
Family BRCA2 tower domain 0.00015
Further Details:      
 
Domain Number 3 Region: 173-295
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.2e-35
Family Single strand DNA-binding domain, SSB 0.0000152
Further Details:      
 
Domain Number 4 Region: 530-643
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.28e-30
Family Single strand DNA-binding domain, SSB 0.00084
Further Details:      
 
Domain Number 5 Region: 298-326,448-527
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.11e-25
Family Single strand DNA-binding domain, SSB 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010385   Gene: ENSGMOG00000009699   Transcript: ENSGMOT00000010667
Sequence length 775
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_2233:16156:29802:1 gene:ENSGMOG00000009699 transcript:ENSGMOT00000010667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LARDLQDMRLRKKKRQTVRPLPGSLFLAKASGGARIPLRAALRQLYQHGVHQPVWTVTAE
NAESFRLSFRRFFRWGSSVSRGVQLADGGWLVPRDDWTLGKEEFYRALCDSPGVDVKLLS
QEWAYNHYRWVVWKLASMERSFPLTMASLWLNPEQILLQLKYRYDVEVDHSRRPALRKIT
ERDDAAAKTLVLCVCGVVPGADQQPQGSHAPPPGVVWLTDGWYAIKAQLDAPLTAMLRRG
GAGGKLVVYGAELVGSQDGCSPLEAPEGLMLKIGANSCRRARWDAKLGFQRDPRPFLLRL
SSLFSTGGAVGCVDLLILRSYPVLWMEKKQDGVFVFRSGRAEEREARRFDDHNNKTMEAL
YAKIQADIQREDKGSARERNSGEELYEAFENDPAYLEACLNDQQLEVLQSYRRSVLEKRQ
AGLQERCRRALEQAQESQGGCPRRDVTPVWKLCVVDARAPPGYMLNVWRPPADLQAQLKE
GARYRVYNLSVTAGKKRNPGASVQLTATSKTHFQEVQVGQDWLSDHFQARQAVHFQELQR
PEVQSACGEVDLVGYVVTTADTHGTSPVVYLVDGDLNLVKVRCFSSLLQWGLEELVKPAT
LLALSNLQLSARRATTLPVLYASDLTAFSSNPREAHLQSSHSNADRXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRRRALDYLSRMPSPPPLGPLGSLAS
PACVKKTFNPPRRSTTPAAVATTRQTPAHGPRVGPWQEEEWENDEGLAQIDTQVL
Download sequence
Identical sequences ENSGMOP00000010385 ENSGMOP00000010385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]