SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000015222 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000015222
Domain Number 1 Region: 284-412
Classification Level Classification E-value
Superfamily Plus3-like 7.45e-42
Family Plus3 0.000000683
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000015222   Gene: ENSGMOG00000014225   Transcript: ENSGMOT00000015613
Sequence length 614
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_2363:237446:251604:1 gene:ENSGMOG00000014225 transcript:ENSGMOT00000015613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKKRKGRVVIDSDSEDSASDDNLDQELLSLAKRKRTDSDEQDEPVSKPTAAASSDSETSD
SDDEWTVGGTKGKKKVKPGKGSDKKTASKKKLHKAAAAAASGSSDGDSSAESSAPEEGEV
SDSDTNSSSSSSDSESSSEDDVFRDGYGEDLMGDEEDRARLEQMTEKEREQELFNRIEKR
EVLKRVMSHNKERRSKRDEKLDKKSQAMEELKAEREKKKNRTAAELLAKREPLKTSEVYS
DDEEEEEEDDDKSSVKSDRSSRSSSYDEDDKEDTPPKSQPVSLPDELNRVRLSRHKLERW
CHMPFFSKTVTGCFVRIGIGNSSSKPXXXVAEIVDVVETAKVYQLGTTRTNKGLQLRHGG
DTRVFRLEFVSNQEFTDNEFMKWKEAMVVASMQVPTLDEITKKEQSIKEAMNHKFNDKDI
EDIVKEKDRFRKAPSNYAMKKTQLFKDKAMAEESGDGEKAKGIQEELNTLEERAEMLDRQ
RTKNISAISYINQRNRSWNIVESEKALVAEGQNTKNQQMDPFTRRQCKPTMVSNARDPSV
HIAILAHLDQKYGSGSSIMDPNALDKNKVKIHSDLSEDLFKVHDFDVKIDLQVPNAEAKS
LSVSSNALPVKDGA
Download sequence
Identical sequences ENSGMOP00000015222 ENSGMOP00000015222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]