SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000000857 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000000857
Domain Number 1 Region: 140-396
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.35e-81
Family Eukaryotic proteases 0.00000342
Further Details:      
 
Domain Number 2 Region: 49-151
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000131
Family Hepsin, N-terminal domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000000857   Gene: ENSGMOG00000000842   Transcript: ENSGMOT00000000892
Sequence length 397
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1457:52080:70784:1 gene:ENSGMOG00000000842 transcript:ENSGMOT00000000892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSPVHRGIYLTCVLTPCRALGVCVTLMTLVAMGAAVWAVGHPPHTSQHLVQVNSADQHLQ
VFDSAQNRWRQVCSSSANELLASISCEEVGFVSVVNYSVASVPEGSSDPGDFFCVKPEEL
SYGKKIRDSLFPCDCESREVLTLLCQDCGRRSLTEDRIVGGLDSRQGSWPWQVSLRYDGV
HQCGGSLISDRWIVSAAHCIRERFRSVSRWRVLLGSVYNNPANATVVEVKTIVYHSSYLP
FVDANIDDNSRDLAVLALSQPIAFSVEYIQPLCLPTYGQRLIDGQMGTVTGWGNVGYNGH
QANVLQEANVPIISDTTCNAPDYYDNQITTSMFCAGFEKGGTDSCQGDSGGPFVAPDCLS
KTSRYRLLGVVSWGTGCATAKKPGVYTRVSRFLPWIS
Download sequence
Identical sequences ENSGMOP00000000857 ENSGMOP00000000857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]