SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002697 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002697
Domain Number 1 Region: 187-279
Classification Level Classification E-value
Superfamily TAFH domain-like 3.01e-34
Family TAFH domain-like 0.00000848
Further Details:      
 
Domain Number 2 Region: 472-520
Classification Level Classification E-value
Superfamily Histone-fold 0.000000000000146
Family TBP-associated factors, TAFs 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002697   Gene: ENSGMOG00000002528   Transcript: ENSGMOT00000002783
Sequence length 662
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_744:238250:246741:-1 gene:ENSGMOG00000002528 transcript:ENSGMOT00000002783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQTTAKSPTVLQNVRTSVPSPINARTIAAQVLAPRIGQQQPNAPNVQNIQLPPGMVLVRS
ESGQLLMIHHQTLAQMQAQSQSQSAMTPRPATPTSTPSVQLASLQAPGGSLLARQVTQNN
LIKQGLGVQTSVQATTTLQRPPVLQVPLGTATTGQPGSAAPAVTQRIGPAGAPPVPTPIS
AVVCICSQETLENVKKCRNFLSTLIKLASSGKQTPETTANVKELVKNLLEGKIEPEAFTS
RLYEELNSSPQPYLVPFLKRSLPALRQMTSDSTAFIHQSQLPLPASTSAALTAMVLRPPL
STTTTASTRTPVVTLTQSPHCKAGSVRVCFCASCCLAHAVLSTCCHTQQQGATVRPQVTL
AQPSLVALRGQPQPRIIMSQPQVVKQLQGPVVKQPLASGTRGVLSAHSALTAAQRNKLKE
GGGGTYRFRDDDDINDVASMAGVDLSEESARILATNSDLVGTVTRSCKDQPFLTTTLLTR
RVLEMGRKFGVCDLGQEVINYISHATKQRLQNLLEKVSEVAQQKNLTFKEDERFEQVTDV
RTQLKFFEQLDKAAKVSRSRQEDPEQLRLKQKAKEMQQQELAQIRQREANLTALAAIGPR
KKRKMGSPANGAVAEPGGSNGGGSRQFTRQRITRVNLRDLLFCLENERESGHSHLLYKGL
LK
Download sequence
Identical sequences ENSGMOP00000002697 ENSGMOP00000002697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]