SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004404 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004404
Domain Number 1 Region: 1-141
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.38e-36
Family G proteins 0.0000602
Further Details:      
 
Domain Number 2 Region: 141-179
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000196
Family SOCS box-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004404   Gene: ENSGMOG00000004162   Transcript: ENSGMOT00000004539
Sequence length 237
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_4548:33920:35661:-1 gene:ENSGMOG00000004162 transcript:ENSGMOT00000004539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IDYKTTTILLDGRRVKLELWDTSGQGRFCTIFRSYSRGAQGILLVYDITNGWSFDGIDRW
IREIDEHAPGVPKILVGNRLHLAFKRQVPTEQARAYAEKNSMTFFEVSPLCNFNVIESFT
ELSRIVLMRHGMEKFWRPNRVFSLQDLCCRSIVSCTPVHLIDKLPLPVAIKSHLRSFSMA
NGMNAVMMHGRSYSVTASAGGGGSKGNSLKRSKSFKPPQSPPKTSSSSSSKGNCKIS
Download sequence
Identical sequences ENSGMOP00000004404 ENSGMOP00000004404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]