SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000005793 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000005793
Domain Number 1 Region: 156-241
Classification Level Classification E-value
Superfamily TAFH domain-like 7.32e-35
Family TAFH domain-like 0.0000413
Further Details:      
 
Domain Number 2 Region: 435-482
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000000931
Family TBP-associated factors, TAFs 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000005793   Gene: ENSGMOG00000005431   Transcript: ENSGMOT00000005963
Sequence length 647
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_515:30980:58464:-1 gene:ENSGMOG00000005431 transcript:ENSGMOT00000005963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VANTTRTAAPQIAVRPQQQTTIQLPPGFTIPPGMVLVRTETGQLVMVPQQVLAQAQAKSQ
QGQAVSNISPRPATPTAGATIRVSAPSPTTQTVRLASPNQPRMVQAGSPSPSVVQAITVA
PAGAGVSGKMPPKPGTVITAGGHALAKPVGVQPGLEMQENVKKCKNFLATLIKLASHNSP
SPDTSKNVKTLVQDLLDAKIEPEEFTSRLQAELKSSPQPYLIPFLKKSLPALRQSLLNNQ
QSLMASGNPHPSVPGPTSTIRARLPNSPVMTPVRTPTPLVNNTAMVXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAV
VRGPPIIAGKSPANLAVQANQKKLSDPGGGFRDDDDINDVASMAGVNLNEENARILATSS
ELVGTKIRSCKDEAFLPTGLLHRRILDTAKKLGVTEVPAEVVNYISHATQSRLRSLLEKV
SAVAQHRGEGGKDEEWAEQSSDVRAQLRFFEQLERMEKQRKDDQEREILLKAAKSRARQE
DPEQARLKAKAKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVASSSG
SGNSPGGSSSRQQLRTRITRVNLRDFIFCLEQERTTSRSLLLYKALL
Download sequence
Identical sequences ENSGMOP00000005793 ENSGMOP00000005793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]