SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007304 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007304
Domain Number 1 Region: 225-573
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 9.81e-60
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.012
Further Details:      
 
Domain Number 2 Region: 2-209
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 6.28e-24
Family Lipovitellin-phosvitin complex, superhelical domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007304   Gene: ENSGMOG00000006860   Transcript: ENSGMOT00000007511
Sequence length 1623
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1770:336066:342846:1 gene:ENSGMOG00000006860 transcript:ENSGMOT00000007511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVVYAMGLLPSPSALLLKDMLLMAQYKQSKPIMFALSNVVRKQFQADQQVTPAITAVAEF
IASLLSSDCPGEKDLTYLTLRVVGNMGEAMEAADPSIKSTLLKCMRQPATTLSVQLAAIQ
AFRRMQLTDEVRANLQRVATYAKGAVQKRLAAYLILMRNPKTSDLEMVKKLFKQEQNPQV
KAFVTSHIYNIVSSTDRNSKKLAKRIMEVLQNTDVPTHTDYTTLSRNYKLGMAHKSMQAN
TKGNIIFDVSSQLPREVMLETTMEVFGYTVDMWEIGMDGKGFEPSVEALFGKNGFFPDTI
SKALYWAVDKMPPRIMVPENLVKEVVANFNKLVKELQAQESPEAMAYLRIMGTELGYIKA
SDLKGYAEYAAHQQMQKLISNTDNEFFAHYIFMDNKASVATGSGFPLKVAMAGIFAPGAK
GGLSMTPNMQEVSFRPSMGIELVTKMGVHVPEFVDTDVAMHTTIYHESALNARISMENNQ
VKLSLPAPQGSTQLFSVRNSNNVLLVNNGREEVISAKDEGRTNVVQCKPFFSGLKYCTTA
RYSAGINNAPYFPLAGETKFAVEIQPTGDVTEYTATIAYKLLTEGKGRQVDSLKMTLKAE
GAASTEASVNMKYNRNRNVFTTNVQIPDYDVETGIRVGMVDSTTKGRSLTFDITNQNIPQ
LSLIGRAKLQDQTDAMLQMQMIVPSMKTDASITATLKNSEDLVLEIKSDVKLPATNSVQA
VVFNEGKDLAEVTLMSNMNSDIKTLQPYTEALQDWMEQLMNEVLDQQVVKTDMKLRHIYN
KALQTGNVWMDKLAYDVPYVHTLKNSLAELEKPTMPENLFMICNESQFRYQFNKDSVSFT
LALPLGGKTSQDLRIPPMLTTPLISLPQMGLEVSPKEISIPTFTIPSDYDLTLPLMGMME
VSGKVKSNYYNLEGTISAGNNTVESPSYVAKIKVIADSPMELFSFTSEGAAEISDTPQDA
IKVIVGGSLKHRFIETSFEVLDKIAITDKVLSTSSYNGKAFSPLGLDTSLDITSQYALAS
NMLTGDANMDGSLTVGSMSASTSYSQTFSAEPLKKEAKTEATLRVNSAFLEVFNKATATF
ANEQLLIESNTNVDIDPLKHTTKFTFGYQDAKLTIQSNSATMADKKMIRNQVDFTATREG
ATIRVENQADDTVNNIYSLLSGSINPSSIEINSDASLNIFGSRASHKATTSLNTIGLISS
CTTTAQSNLLTFENVFAGTVDTSGATMTINTKGAVKENTVELNVDAKALISEVYLNSILK
SNVFDANTRNRLNLRLNKEGCSFSNNMVGSLGEMKTDNTQSLDLTLRSLSLSSKTDNILN
TGNYYKHDITVNVESFTTSVNVKNDLRILEVNFENEAQFVAKPYTIEMTGITTGLLSEEQ
LRHTYEFKFVDMILSAKCNTNGQLLGSQMTHTSDMEIADWTMKFNNMANINTKPLRLDST
VKSIVTPFSMSIDAILNSNGEIQLYGEQSGELYSKFLLKAEPLSMVQSFEYRASTTHELQ
NGASYKTNMDNKFNSMMTLKEQSVTVGIASKMNNHAFDHELTAFNKAEQMGMAMKGALAT
TFFNGASENHEYSISGSVNYDKSSDTHFIQIAFLEYLPETIEELKNLVVRLVDNSMDMLR
NID
Download sequence
Identical sequences ENSGMOP00000007304 ENSGMOP00000007304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]