SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010174 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010174
Domain Number 1 Region: 10-189
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.53e-45
Family G proteins 0.00002
Further Details:      
 
Domain Number 2 Region: 189-228
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000222
Family SOCS box-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010174   Gene: ENSGMOG00000009498   Transcript: ENSGMOT00000010451
Sequence length 279
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_3135:3331:7188:-1 gene:ENSGMOG00000009498 transcript:ENSGMOT00000010451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSQGSPVKSYDYLLKFLLVGDSDVGKGEILDSLQDGSAESPYAYSSGIDYKTTTILLDG
RRVKLELWDTSGQGRFCTIFRSYSRGAQGILLVYDITNRWSFDGIDRWITEIDEHAPGVP
RILVGNRLHLAFKRQVPTEQARAYAEKNGMTFFEVSPLCNFNVIESFTELSRIVLMRHGM
EKFWRPNRVFTLQDLCCRAIVSCTPVHLIDKLPLPVAIKSHLKSFSMANGMNAVMMHGRS
YSLASGPAGSKGNSLKRNKAVRPPQSPPQSCTRSNCKIS
Download sequence
Identical sequences ENSGMOP00000010174 ENSGMOP00000010174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]