SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000017974 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000017974
Domain Number 1 Region: 625-1045
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.37e-128
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000791
Further Details:      
 
Domain Number 2 Region: 23-288
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 3.45e-86
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000132
Further Details:      
 
Domain Number 3 Region: 288-623
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 8.24e-85
Family Lipovitellin-phosvitin complex, superhelical domain 0.000000307
Further Details:      
 
Domain Number 4 Region: 1234-1404
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.57e-59
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000017974   Gene: ENSGMOG00000016366   Transcript: ENSGMOT00000018415
Sequence length 1703
Comment pep:known genescaffold:gadMor1:GeneScaffold_1780:1291970:1301435:-1 gene:ENSGMOG00000016366 transcript:ENSGMOT00000018415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGLIVLAVSLVLVELMGFSPEFAVGKTYTYKYEAVILGGLPEAGLARAGVKLSSKVIIN
AEAPNTFLLKLVDPELYEYSGIWPTDPFVPATKLTSALAAQLLTPIKFQYANGVVGTIFA
PAGVSTTVLNVFRGVLNLLQLNIKKTQNVYELQEAGTQGVCRTHYVIREDVKTERLHLTK
TKDLNHCQELIHKDIGLAYTEKCVQCQAQGMALKGAVAVNYILKPAATGALLLEATATEL
IQFSPFNILNGAAQMEAKQLLTYVGISKTPVLPIAAAYIPRGSLQYEFATELLQTPIQLL
RITNVEAQIVEVLIHLVTYNVAKVHEDAPLKFVELIQLLRVVSYERIDALWSQYKVKPAY
RHWFLNAVPAIGTHVSLKFIKEKFHLDDISVVEAAQALIGSIHMVTADLESIKLVEAMIS
HHKIQANAVLREVVMLGFGTMVNKYCVATPLCPVDLVKPIHDLLIQSVAKVDIDGAIIAL
KVLGNAGHPASLKPIMKLLPGFSTAAAALPLNLHIEAILALRNIAKKEPKLIQDLAVQVF
MDKALKAEIRMAAALVLFETRLPMGLVTAIADATLKESNLQVASFVYSYMKSMTKNTAPD
YASVAAACAVAMRMLSPKFDRLSLRFSRALYLDAYHNPMMVGAAASAFYINDAATVMPKA
VVAKARTYFAGAYADVLELGVRTEGIQEALLKLPQAPVDADRITKIKHFIRAISNWRATA
VNQPLASVYVKFFGQEIGFASIDKAIIDQLIQVASGPSIATYGRKALEALLSGFSFHYAK
PMLVAEVRRIMPSNTGLPIELSFYTAAVAAATVEFATTVSPPLPLNFAAAQLLKSDIEIR
TAVTPSVSMHTYAVMGVNTALIQAAIMSIAKIHTIVPAKIEARIDVIKGNFKIQALPVQG
LNKITAATVETFAIARNAEDLAAAKLTPMIPVKSNTLSREIFTSKIASKLASLTSSLSKS
SEIIPVDLPGNLIRKINLNAAFAKKMCGELKTFGIKVCAEIESRNAAAIKDCPLYAVVGK
HALILEISPAAGPVIEKIEVEIQVGEKAVEKIIKVINRSQEEETVEERNVLLKLKKILVP
GLRNATRSSSSSSSSSSLKSSSSSSSSSRSSSSSSSSSSFIQRPRVEGDACFWSQFLGLK
KTSTSTHEIDFCFKFSNSHSRLTSTRCVICNFSLKKYNYTSSYAYWSLRYVFHSPIIFYV
FQHSVSAARTSSRSSAASFEAIYNKAKYLANAINPTVTILVRAVRADHKAQGYQATAYWD
KPASRVQLILANLVEENHWRICADAVLLSYEKIMAKVAWGIDCKEFETKINVETGLVGKS
SAMRLKFTWDKLPTSAKRYAKISRLSDYLGNAAQLAGLEMSKAKNSLKQLKLTLALTSDK
TLNVVLKTPKRTFYKLAVILPVYIPVGNTADELVAYQNSLSDKIIYVLTKANAAVCTIVN
DKVTTFNERIFKNQMPESCSQVLAQDCTEDLKFIVLLKKDLASNKKQINVNIADIEVDLI
PLNNNIIVKINGVILPTANLPYQHPTNKIQIKKLREGIALHAPSHGLQEVFLDANTLKVK
VADWMKGQTCGLCGKADGEVREEYQTPNGRLASNSVSYAQSWVIPAESCRDLSKCYMKLE
SVKLEKQMILHGEESKCFSVEPVLRCLSGCTPLKTIPVTVGFHCLPADSNMSSTHLNNIY
EKSEDLKENTEAHLACRCSAQCA
Download sequence
Identical sequences ENSGMOP00000017974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]