SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018204 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018204
Domain Number 1 Region: 620-875
Classification Level Classification E-value
Superfamily YWTD domain 9.55e-56
Family YWTD domain 0.00000406
Further Details:      
 
Domain Number 2 Region: 6-267
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-54
Family YWTD domain 0.00000151
Further Details:      
 
Domain Number 3 Region: 319-557
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-52
Family YWTD domain 0.00000341
Further Details:      
 
Domain Number 4 Region: 923-1184
Classification Level Classification E-value
Superfamily YWTD domain 5.49e-37
Family YWTD domain 0.0000529
Further Details:      
 
Domain Number 5 Region: 1310-1347
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000903
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 878-925
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000019
Family EGF-type module 0.013
Further Details:      
 
Domain Number 7 Region: 1234-1272
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000982
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 576-622
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000293
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 9 Region: 273-314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000135
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 10 Region: 1274-1308
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000223
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 11 Region: 1191-1244
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000733
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018204   Gene: ENSGMOG00000016937   Transcript: ENSGMOT00000018652
Sequence length 1505
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_132:295:81198:1 gene:ENSGMOG00000016937 transcript:ENSGMOT00000018652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPPGVPLLLYANRRDLRLVDAAHGKANATVVVGGLEDAAAVDYVYARGLIYWSDVSEEAI
KCTAFNRSGDGSAQTVVVSGLASPDGLACDWLGGKLYWTDSETNRIEVAELDGSLRKVLF
WQELDQPRAIALDPERGYMYWTDWGEVPKIERAGMDGTHRAMIIEKEIYWPNGLTLDYSE
QKLYWADAKFNFIHRSNLDGTSREPVVQGDLPHPFALTLYEDTLFWTDWNTHSIHACRKQ
TGEDRRKIHSDIFSPMDIHVFSAWRQPTAVPTPCSLENGGCSHLCLLSPATPFYRCACPT
GVQLLDDRKTCRNGPTQVLLLARRTDLRRISLDTPDFTDIILQADDIRHAIAIDYDPVDG
HIYWTDDEVKAIRRSALDGSDAQFVVTSQVNHPDGIAVDWIARNLYWTDTGTDRIEVTRL
NGTMRKILISEDLDEPRAIVLDPVAGYMYWTDWGEVPKIERADLDGMERLVMANTSLGWP
NGLALDYHERKIYWGDAKTDKIEMMNMDGSGRRELVEDKLPHIFGFTLLGDYIYWTDWQR
RSIERVHKRTAEREVIIDQLPDLMGLKAAYVHEAHGTNACAEANAGCSHLCLFTPRGAQC
ACPSGLELIADMATCIVPEAFLLFSRHTDIRRISLETNNNNVAIPLTGVKEASALDFDVT
DNRIYWTDITLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVA
KLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGTGRLTLVPDVGR
ANGLTIDYAERRLYWTDLDTTLIESSNMLGKEREVIADDLPHPFGLTQYQDYIYWTDWSQ
RSIERANKTSGRNRTVIQGHLDYVMDILVFHSSRQGGWNACAATNGHCSHLCLAVPVGGY
VCGCPAHYSLNLDNKTCSAPTSFLLFSQKTAINRMVMDEQQSPDIILPIHSLRNVRAIDY
DPLDKQLYWIDSKQNAIRRAQDDGNQSMTVVSSQVGGLNMGLQPYDLSIDIYSRFIYWTS
EVTNVINVTRTDGRRVGVVLRGEHDKPRAIVVNPERGYMYFTNLLESSPKIERAALDGTE
REVLFFSGLGKPMALAIDNELAKLFWVDSELKRIESSDLSXXXXXVIEDSNILQPVGLTV
YGPHLYWIDRQQQMIERIDKTTREGRTKIQARIATLSDIHAVHELDMAEYTHPCSRDNGG
CSHICIAKGDGTPRCSCPVHLVLLQDLLHCGEPPTCSTEQFTCSTGDIDCIPKAWRCDGF
AECDDNSDEEGCPVCLPSQFQCDRRCVDGALRCNGEPDCTDHSDELDCDVRCPPDQFSCT
NGQCIGKHKKCDHNMDCTDNSDEIGCXXXXXPTDEPSQQPSNTISTIVGVVLALFVVGAV
YFGCQRVLCPATKDDGETVTNDFVVHGPSVPLGYVPHPSSLTGSLPAGMSRGKSVIGSLS
IMGGSNGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATVRSQYTIEFGYSSNSPS
THRSY
Download sequence
Identical sequences ENSGMOP00000018204 ENSGMOP00000018204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]