SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018805 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018805
Domain Number 1 Region: 234-590
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 3.84e-61
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.013
Further Details:      
 
Domain Number 2 Region: 17-211
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 1.7e-24
Family Lipovitellin-phosvitin complex, superhelical domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018805   Gene: ENSGMOG00000017133   Transcript: ENSGMOT00000019263
Sequence length 1733
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_2684:76047:87739:1 gene:ENSGMOG00000017133 transcript:ENSGMOT00000019263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALVHGLSLQGHADAGRVRDMLSTAKFRQSKAIMYALAYTVRRFYRNSEGLRIPELTQVSD
FMATILEDCSVNPEESFLALRVVGVMGRVIQKDGDQLIPSILRCAQSDTAPQSNQKAAIQ
AFRRMSITDEIQNVLMEICRNPQSPVEHRVAAYLTLMKRADQAMITQLLNTLAGEEEPQL
KNFVFSHLDNIRNSLDPDMQRMRSNVEAAWRGQPSSSFRGPSTSGSYRLETPLGSVQTNL
IFDGADTLPKEVMLETTLRVLDFREDIFEVGVEGKGFEPTLDALFGERGFFPEAASNSMY
NSGAYKVPKVLQRIFDRLAPDGNRMKRQDLLLDIKNSFNALLHDIGSYPPPEATAYLTLL
GREMGYIKSSEVKHMADTLYTYYQTFFKQLPAKAIAALTSSTENDLFAHYIFMENVMSLP
TASGLPLKFSLAGVITPGARGGLNLAPGMQQLSFMPSVGLEFITQMGVHLPDFVVAGLEM
HTNMHHESSFNAKVTMTNNQFKLSIPALKTNTLFSFSNKVLSVSSSGMATVPSMVEDKVE
SMECDALFPGLKLCTAARYPNVNSTDETPYYPLTGETRFAIEIQPTGEVSEYIATLTGET
LREGKDGRHKVDSLKLSLKAEGRSTESKEATAILKYNRNKNIFTTEVNIPDFDMELGIKL
AVTDTNVKGKKMKGVTFDVSNKHIPQLTLVARTRLEMMKNAMLELQMAIPSLKADSALTL
TLKNDDAVIMAVEAALNLPETTSVQKVTLIYDDNKFEVEMNSDTNSDIQKLIPNIENYHR
QLQQHIDALLDQRVAQTDMKLRHIVTKGIEAGNIWLDKLSASIPSIEKLRSKRSISDLTL
PALPERLFFQADSLFRYQFNKDKMDVNIPLPLGGKSSEEIHFPATLSVPNINIPTLGVHI
PAKTYPVPTFTIPRSVDFTVPLLGLFEASTKINSNLYNWEGSIAGGNNTMDVPNYIVQYK
AMAQSPFNPLSYTIEVEGTGMVSGKVDNVKYIVNGSLSHSLIDASFSISEGLRMIDNLIA
RVNYKLLVSSPLGLQSSLDYSALSTSTADKVTGDGKLDGLLEIGPLHTTATYTQSYILLP
QVREGRGESSLRISSPLIQLNNIIQGVYANNELNIVSKTNVQDQVLQHVSELKYKGAQVT
LKSNVVAAALGKMLNNKLELGLSSQLVIFRIESQADDATNRAFSLLTGTVTSYGLEVNSE
GSLTSNVGRALHKASLTINQNGVTTSGTNNIQCSPVTFENVFNSNIDQSGVTLSSLSKAM
AEEARGELNIEVKVTTTEASLNGVFKGYAHDASTRNNLNFLLNRRTLSISSNSMGSLKQR
KTENSHTLVLTLWTADLHSKTDNFICEDVYYKHDIKMNMKPFVMSIDVTNDLKLQSLNFN
NEGHLRLQPIMMDLTGSLKGANGEVDQIKHTYQIKYADMAGTMKSSTSGRIMDVKLSHNC
EFEFAGLASKSICEAQVTSESLRFDGNIRTMAVPFSFTLDGLINSDGELNLFGKHTGQLY
SKLLIKAEPAALAYSQDCQVSTKHTLESGVSSAHIDNKCNGLLTPSKQSLNWKSQSKMNR
QDYNQEINTYNDPAKIGFEFSGVLLTDLFSQLNYIRETKLPEIQEFKTSGFLKYDKNSDC
HTVEIPFIKSLPAAFDIVKEALLKALESLQQYVNRIDVILLIKQFRTRLNQIPMEVNDLI
RQMDLENKVKEIKEKVTYLTKDFSVTIDDLELAVEKLKTDFGKTVIEIAHKIQ
Download sequence
Identical sequences ENSGMOP00000018805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]