SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000019640 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000019640
Domain Number 1 Region: 29-262
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.16e-76
Family Calponin-homology domain, CH-domain 0.0000824
Further Details:      
 
Domain Number 2 Region: 1332-1447
Classification Level Classification E-value
Superfamily E set domains 1.67e-35
Family Filamin repeat (rod domain) 0.0000152
Further Details:      
 
Domain Number 3 Region: 456-570
Classification Level Classification E-value
Superfamily E set domains 1e-31
Family Filamin repeat (rod domain) 0.00054
Further Details:      
 
Domain Number 4 Region: 1065-1160
Classification Level Classification E-value
Superfamily E set domains 1.27e-30
Family Filamin repeat (rod domain) 0.0000158
Further Details:      
 
Domain Number 5 Region: 1829-1923
Classification Level Classification E-value
Superfamily E set domains 2.2e-29
Family Filamin repeat (rod domain) 0.00000948
Further Details:      
 
Domain Number 6 Region: 1425-1532
Classification Level Classification E-value
Superfamily E set domains 1.27e-28
Family Filamin repeat (rod domain) 0.0000493
Further Details:      
 
Domain Number 7 Region: 672-780
Classification Level Classification E-value
Superfamily E set domains 1.67e-28
Family Filamin repeat (rod domain) 0.00062
Further Details:      
 
Domain Number 8 Region: 1148-1252
Classification Level Classification E-value
Superfamily E set domains 2.2e-28
Family Filamin repeat (rod domain) 0.00015
Further Details:      
 
Domain Number 9 Region: 2013-2107
Classification Level Classification E-value
Superfamily E set domains 2.34e-28
Family Filamin repeat (rod domain) 0.0000241
Further Details:      
 
Domain Number 10 Region: 1533-1640
Classification Level Classification E-value
Superfamily E set domains 1e-27
Family Filamin repeat (rod domain) 0.0000184
Further Details:      
 
Domain Number 11 Region: 366-476
Classification Level Classification E-value
Superfamily E set domains 6.67e-27
Family Filamin repeat (rod domain) 0.00076
Further Details:      
 
Domain Number 12 Region: 1244-1354
Classification Level Classification E-value
Superfamily E set domains 1.4e-26
Family Filamin repeat (rod domain) 0.0000234
Further Details:      
 
Domain Number 13 Region: 2288-2381
Classification Level Classification E-value
Superfamily E set domains 1.67e-26
Family Filamin repeat (rod domain) 0.00000947
Further Details:      
 
Domain Number 14 Region: 2482-2573
Classification Level Classification E-value
Superfamily E set domains 4.54e-26
Family Filamin repeat (rod domain) 0.000012
Further Details:      
 
Domain Number 15 Region: 757-872
Classification Level Classification E-value
Superfamily E set domains 6.27e-26
Family Filamin repeat (rod domain) 0.00071
Further Details:      
 
Domain Number 16 Region: 280-375
Classification Level Classification E-value
Superfamily E set domains 3.07e-25
Family Filamin repeat (rod domain) 0.001
Further Details:      
 
Domain Number 17 Region: 2624-2713
Classification Level Classification E-value
Superfamily E set domains 1e-24
Family Filamin repeat (rod domain) 0.00000984
Further Details:      
 
Domain Number 18 Region: 576-667
Classification Level Classification E-value
Superfamily E set domains 1.53e-24
Family Filamin repeat (rod domain) 0.0002
Further Details:      
 
Domain Number 19 Region: 861-971
Classification Level Classification E-value
Superfamily E set domains 2.2e-24
Family Filamin repeat (rod domain) 0.00082
Further Details:      
 
Domain Number 20 Region: 1630-1739
Classification Level Classification E-value
Superfamily E set domains 8.01e-23
Family Filamin repeat (rod domain) 0.0001
Further Details:      
 
Domain Number 21 Region: 2389-2480
Classification Level Classification E-value
Superfamily E set domains 3.14e-21
Family Filamin repeat (rod domain) 0.0000139
Further Details:      
 
Domain Number 22 Region: 979-1078
Classification Level Classification E-value
Superfamily E set domains 1.07e-20
Family Filamin repeat (rod domain) 0.0014
Further Details:      
 
Domain Number 23 Region: 2224-2305
Classification Level Classification E-value
Superfamily E set domains 1.8e-19
Family Filamin repeat (rod domain) 0.0002
Further Details:      
 
Domain Number 24 Region: 1933-2028
Classification Level Classification E-value
Superfamily E set domains 5.2e-17
Family Filamin repeat (rod domain) 0.0000773
Further Details:      
 
Domain Number 25 Region: 1768-1845
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000127
Family Filamin repeat (rod domain) 0.000098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000019640   Gene: ENSGMOG00000018206   Transcript: ENSGMOT00000020119
Sequence length 2715
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1811:138:54381:-1 gene:ENSGMOG00000018206 transcript:ENSGMOT00000020119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSNNYDDQLPPQYSQEFGDEEDDEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCVSK
NINDLQRDFGDGLKLISLLEVLSQKKMYRKHHIRPNFRQMKLENVSVALEFLDREHIKLV
SIDSKAIVDGNLKLILGMIWTLILHYSISMPMWEDEEDEDAKKLTPKQRLLGWIQNKVPQ
LPIKNFHRDWNDGKALGALVDNCAPGLCPGWADWDPNQPVENAREAMQQADDWLGVPQVI
APEEIVDPNVDELSVMTYLSQFPKAKLKPGAPLKNKQLFPDKAKAFGPGIEPHGNTVLQP
AVFTVDTQEAGSGEVLVYVEDPEGYKEEAKVKPVKNKSGTYTVTYTPKVEGVHRVKVLFA
GQDIDKSPYTVNVTKTMGDASKVHARGPGLDATGNVANKPTYFDIYTAGAGNGDVSVVVI
DPQGKKDTVELVLENKGDSVFRCTYRPVLQGPHVIHVLFAGQEIPKSPFTVNIAEAMNPS
ICRATGRGLQPKGVRMKEVADFRVFTKGAGPGELQVSVKGPGDTEEKVNVREVGDGVYEC
DYVPLKPGKYTVTITWGGQPIPRSPFVVEVGLEAGFQKVRAWGPGLKTGMVGKSADFVVE
AIGTEVGTLGFSIEGPSQAKIECDDRGDGSCDVRYWPTEAGDYAVHVICDDEDIKDSPFM
AHILPAANDVFPEKVKAFGPGLRPTGVVVNKPTEFTIDARMAGKGHLKIYAQDAQGCTID
IQINEKGDGTFLCVYTPSKPIKHTIIVSWGDVNVPNSPFRVLVGEGCHPDKVKVYGPGVE
KSGLKANEPTYFTVDCGDAGQLGDISIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYT
PPGAGRYTIMVLFADQEIPVSPFKVKVDPSHDAGKVRAEGPGLNKTGVEVGAPTHFTIYT
KGAGKARPEVHFAVSGAGEAVRDFEIIDNHDYSFTVKYTALQQGNMAISVTHGGDPIPKG
PFHISVAPALDLSKIKVEGLDTKVEVGKDQEFTVNSQGAGGQGNVGVKMTSPSGRPIPCK
TESDKAGGTHGVKYIPPEEGQYKVEVSYDGHPVAGSPFGVEGVMPGDPSKVRAYGPGLKG
GIVGKPAFFTIDTLGAGAGGLGLAVEGPCEAKLECRDNGDGTCSVTYLPPVVGEYDINIL
FAEQHVPGSPFKAVVRPAFDPAKVTAYGPGLERARAGEQASFTVDCSRAGEAELTIEIVS
ESGAKAEVRVQKTAEGTFSVSYTPPFHGAHTITVKYGGGVIPQCPKVIQVEPAVDTSGVK
VYGPGVEPRGVLREVTTHFIVDTRALSKAGGGRIKVHVINPSGGSTETFVTDKGDTYRVE
YTAFEDGMHLIEVLYDDVAVPKSPFRVSVVEGCDPTRVRAYGPGLEGGVTNKANCFTVET
RGAGTGGLGLTVEGASESKMSCKDNKDGSCSVEYVPFTAGDYDVNITYGGHPIPGSPFRV
PVRDPVDPTKVKCSGPGLGSGVRAHVPQSFTVDCTKAGQAPLDVKLYGPTGTAEPVGVKN
NGDGTHTVHYTPGQDGPYSVAVKYADQEVPHSSPFKVKSQPGHDASKVRASGPGLDTKGV
SASIPVEFTIDAREAGEGLLTVQILXXXXXXXKASIQDNRDGTYTVSYVPDSVGNYTITI
KYGGDEIPYSPYRIKSLPTGDASKCLLTXXXXXXXXXGLQRLQTSEDTVITVDAKAAGKG
KVTCKVMTPEGAELDMDVVENHDGTFDIYYTAPEPGKYVITIRFGGQNIPKSPFHVVVSC
QASNEPVAPRDSVDPLFRPLNLVVPFTPQQGEITGEVRMPSGKTARPHITDNKDGTITVK
YQPAERGLHEMDIKYEGNHIPGSPMQFYVDATNSGIVTAYGPGLSYGMVNRASTFTVVTK
NAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYLPTVPGDYSVIVKFDNKHIPGSPFTAK
IAGDDAITRTSQLNVGTAADLSLKIAETDLSVLSASIRAPSGNEEPCLLKRLPNRHIGIS
FTPKEVGEHEVNVRKNGAHVANSPFKIMVGQSEIGDASRVKAFGKGLTEAHTFEMAEFFV
DTRNAGYGGLALSVEGPSKVDINCEDMEDGTCKVSYTPTEPGNYVVNIKFADKHIPGSPF
AVKMTGEGRMKESITTKRQASSIASVGSTCGLNLKIPGNWFQMVSAQERLTRTFTRSSHT
YTRTERTEISKTRGGETKREVRVEESTQHGGRGSPFRDVFGDFLGRESLSSFAGITARPE
XXXGGPQVMTAQVTSPKGKTTDADIVDGGGCSYSVRFIPQEMGPHTVNVKYRGQHVPGSP
FQFTVGPMGEGGAHKVHAGGTGLERGIAGNPSEFSIWTREAGAGGLSIAVEGPSKAEISF
EDRKDGSCGVSYVVKEPGDYEVSIKFNNEHIPDSPFVVPIATLSDEARRLTVTSLQEKDM
KVNQEASFMVQRNGARGVVDAKVHTPAGSAEECYVTELDSDKNTIRFIPRENGVHSIDVK
FNGCHIPGSPFNVRVGEPGQVGDPGMVSVHGPGLQGGITGVPAEFVVNTCNAGSGALAVN
IDGPSKVKMDCQECGEGYKVTYTPMAPGSYLIAIKYGGQQHIVGSPFKARVTGVRLSGGH
SLHETSSVLVETVTKSSKVGGAYSASSCSSSSSSLSSSAKLTSDASKVVCRGPGLSKALV
GQKNCFTVDCGKAGTNMLMVGVHGPRAPCEEVYVKHVGNKLYNVSYTVKEKGSYTVIVKW
GDDSVPGSPYKVSAP
Download sequence
Identical sequences ENSGMOP00000019640 ENSGMOP00000019640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]