SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000003213 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000003213
Domain Number 1 Region: 252-316
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000251
Family VWC domain 0.0083
Further Details:      
 
Domain Number 2 Region: 108-175
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000146
Family VWC domain 0.048
Further Details:      
 
Domain Number 3 Region: 29-95
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000133
Family VWC domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000003213   Gene: ENSGMOG00000003045   Transcript: ENSGMOT00000003313
Sequence length 443
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4238:721428:725509:-1 gene:ENSGMOG00000003045 transcript:ENSGMOT00000003313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TYSRTLISLFIFITWLADAELKTTKVSGTTCTFKDKIFSPGDSWHPYLEPFGFMFCMRCM
CTEAGHVKCNTIRCPALTCENSVTEPQQCCPRCPDEPRVPAGLRASVKTCRYNGSVYQPG
ESFTKHDLFPSRQTNQCVMCTCSNGNIFCALKTCQSLSCSSPVPLPDTCCMVCRDQLTSG
SSSTEDGNQQLNRGVRHSVDQCSEEPLVRDRSGVLGATPPQVGPWGLGLGKLNLKGAADT
TVKIFLQKKQQKACSYNSKTYSHGETWHPVLGRVLECILCSCSDGLQDCRRITCPNQYPC
KRPTKSAGKCCKTCPELRAETNQSKCHHGYRNNVLVYKVEPVRNDSDDIRTIAIEKLGLT
EVELQTWKTVGEDLQLLEITEVERRNVTDHPESYTLLATVAEDTWKKFKGEISDNSQTTV
CDDGIREIVNYLNPKHTEDMCSP
Download sequence
Identical sequences ENSGMOP00000003213 ENSGMOP00000003213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]