SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000006152 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000006152
Domain Number 1 Region: 1-348
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 2.75e-61
Family ADP-ribosylglycohydrolase 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000006152   Gene: ENSGMOG00000005789   Transcript: ENSGMOT00000006328
Sequence length 353
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2910:116198:122506:1 gene:ENSGMOG00000005789 transcript:ENSGMOT00000006328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKFQAGMVLGATGDALGWRKGHWGGCTSGRQIQEELASLGGLGDLTLDPELWPPGDSAL
MHMTTAQALITDYWCLEDLYRELVRVYVAASGVLRGRTPDPSKVDCCSHLKPNNFLLAWH
TPFNEKGSGSGGASKAMCVGMRYWQEERLGSLMEVSLEAGRMTHNHPTGFLGSMTTALFA
SFAVQGRPPVTWGRELMKAIPKAYEYCKRTIRHMAEYQENWFYFEAKWQFYLEERGIEQE
GQDKPLFPDPYDADQTDKMYRLWSSEGRAGRRGHDAPMIAYDALLAAGSNWTELCRRAMF
HGGESDVTGLIAGCLYGLMYGLSQVPAGLVKDLDKRQQLEDIGAALFKAASAE
Download sequence
Identical sequences ENSGMOP00000006152 ENSGMOP00000006152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]