SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000016320 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000016320
Domain Number 1 Region: 5-322
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 2.22e-40
Family ADP-ribosylglycohydrolase 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000016320   Gene: ENSGMOG00000015233   Transcript: ENSGMOT00000016736
Sequence length 325
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3164:163130:166556:1 gene:ENSGMOG00000015233 transcript:ENSGMOT00000016736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QMALTLADRAIGAIVGSAVADSAAQPLHWVYDLQKLKVLLAKQPHPEFNPESVNPFYRRD
TGQQSCYGDQAYVLLESLAECGGLNVEDLKQRTLKAFGPGSEYDTPVNDPYKVPLPIQGP
WRHASLKGFLKNVDAGKQDTGRTGIDGVAKLAPIVAFYAGKPDMLEKVESAVRVTQNNDA
CVVETLAAARILEHFILNGSDPKALDCVMDQLNDPNRAHPQDGDGERNVRHKNHAQIIIF
LHLHSSSLPGAFQAALHGVLTAKGYEQAVRETMSCGGCTCSRSSFIGACLGAQIGLEGIP
SSWRSKTLRYGSLLELAKKIAEQHQ
Download sequence
Identical sequences ENSGMOP00000016320 ENSGMOP00000016320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]