SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018390 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018390
Domain Number 1 Region: 5-319
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 3.01e-41
Family ADP-ribosylglycohydrolase 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018390   Gene: ENSGMOG00000017113   Transcript: ENSGMOT00000018841
Sequence length 320
Comment pep:novel genescaffold:gadMor1:GeneScaffold_547:16873:29169:1 gene:ENSGMOG00000017113 transcript:ENSGMOT00000018841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QMASDLADRAIGAIIGAAVADAAAQPMHWIYNLDSLKEVLSKLEPFPEFRAESANPFYRR
ETGEQTCYGDQAFVLLESLSHCGDVNAEDLTQRTYSFFGPGTVYDLPRPKAELPINGPWR
NASLKSFIRNVDARKEETGXXXXXMDCVTKIAPVVAMFAGRAQMLDKVEMAVRVTQNNDI
CVAMALAAARFVEHFILNGPDPNVLDAVLGQLKDPARQNPQELDKAVIXXXXXXXXXXXX
XXXXXXLPDALQGALHGLLTHSRLEEAVRDTMRCGGCTSSRASFIGACFGAQTGVQGIPE
SWRNRTFRYPLLIQLANKVV
Download sequence
Identical sequences ENSGMOP00000018390 ENSGMOP00000018390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]