SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018872 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018872
Domain Number 1 Region: 2-337
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 4.32e-64
Family ADP-ribosylglycohydrolase 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018872   Gene: ENSGMOG00000017560   Transcript: ENSGMOT00000019331
Sequence length 341
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2409:156605:166289:1 gene:ENSGMOG00000017560 transcript:ENSGMOT00000019331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSRFKGALVGAVLGDCVGGEFEGAEEVPMENVLRHLNGLDDETKGDGTLEYSDDTAMARC
VVQSLLTRAGFDEQDMARRFAKEYSLAPGRGYGSGVIQVLKKLSSSQLSDVYQPARDQFN
GRGSFGNGGAMRVAPFALAFPDLSDVKKYSRSGAMLTHSCSLGYNGAVLQALAVHLSLQG
ALELPAQFLDKLISEMEEVEDEEASRNDARALKEAEKPFCERLYRLRDLMDRSKVSIEEV
ICELGNGIAALHSVPTAIFCVLHCLQPRESLPPHYGGLERTMAYSLALGGDTDTIACMAG
AIAGAHYGIEVIPEAWMKCCEGAKEAEVTAQRLHALYHQRA
Download sequence
Identical sequences ENSGMOP00000018872 ENSGMOP00000018872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]