SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g001266m|PACid:18131010 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g001266m|PACid:18131010
Domain Number 1 Region: 419-585
Classification Level Classification E-value
Superfamily BRCA2 helical domain 2.62e-39
Family BRCA2 helical domain 0.00061
Further Details:      
 
Domain Number 2 Region: 586-714
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.83e-38
Family Single strand DNA-binding domain, SSB 0.00014
Further Details:      
 
Domain Number 3 Region: 718-747,865-950
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.4e-25
Family Single strand DNA-binding domain, SSB 0.01
Further Details:      
 
Domain Number 4 Region: 748-865
Classification Level Classification E-value
Superfamily BRCA2 tower domain 1.2e-19
Family BRCA2 tower domain 0.0024
Further Details:      
 
Domain Number 5 Region: 956-1108
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000617
Family Single strand DNA-binding domain, SSB 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) orange1.1g001266m|PACid:18131010
Sequence length 1112
Sequence
MSTWQIFSDADNNFKWQVSGRILQPEPNGSPIQPHSSSFRLPSMSDLLLEGHSKLRENGN
EGADNVSTPMFKTGSGKAVPLKQSSIEKALSVLGTDNDCGISFAGEEHPRENGFGFSNSL
FQTGSGKTVNISSAGLVRAKSLLGLEEGRNDWSFEGLQHTRMTSTPRFEVKEGVKGNVFE
SDTSVLRPSSISKAGFAESRFKNKISSNMMQTEGLNSAPKPPQIKFQTAGGRSLSVSSDA
LQYARNLLGDPELGTFFHEVDVDQLDLTSFKHRRFDDSSSNKENDVFTSFFRLGTAGTKT
ASKNFTSPLRLFSNPVRSRINSENINTSANLIEKFDAVDHDGVSGLNGKIPSIKKPIRST
HGHKAIMDNSVEDDIGSKINSLGRSSGKPLADITNSTSTACANIKQTCEKKRLLRSSISP
FKRPRISKFSTPLRTNLSSPNGLSTLSSEQSGCEKKVFSRYPYQIPRMCVKEYFGMPPSA
QGMLDHLQDQVRQMKSHNADKYMFHDASGLNCIGAEALFNMLAQSGASTQYASKLWVSNH
YKWIVWKLACYERCYLAKSAGKFLTVFNVLEELKYRYEREVNNGHRSAIKRILEGDALPS
SMMVLCISAIHMNCVPKIETHPEAQNGAENSYAAKLELTDGWYSVDAFLDVLLSKHLAAG
KLFVGQKLRIWGAILCGWVGPVSPLEASGSISLQLNINGTYRAHWADRLGFCKGFGAPLA
FRCIKSNGGPVPRTLVGVTRIYPVLYKERLSDGRSIVRSERMECKVMQLYQHRQSMVVEG
IVSEFQRGNKDSHILNDSNSEGAKLFKMLETVAEPEVIMAEMSPEQLTSFATYQAKLEAT
RQSNMERSIEKALENAGLRERDVTPFMRVRVVGLTGKNYQGKGSSREGIITIWNPAEKQQ
CELVEGQAYAILGLIPMNSDSNTLYLQARGSTTKWQPLSPLATEHFKPFFSPRRSVLISN
LGEVPLSSEFDIAAFVVHVGDVYEDSQQKKQWVFVTDGSMLELQLEDLSKSLLAISISSP
YIDDDSFSPINYNLVGSTVGFCNLIKRPKDHLNHIWVAEATENSSYFLSFDFPTCSHLRS
AAASAQSWAKISSLIIDKLKENVLFIIGDRKC
Download sequence
Identical sequences A0A067F7B4
orange1.1g001266m|PACid:18131010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]