SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g002515m|PACid:18107440 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g002515m|PACid:18107440
Domain Number 1 Region: 1-151,272-319
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.71e-57
Family Tandem AAA-ATPase domain 0.00000168
Further Details:      
 
Domain Number 2 Region: 321-429,525-607
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.77e-40
Family Tandem AAA-ATPase domain 0.0000406
Further Details:      
 
Domain Number 3 Region: 150-271
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 2.75e-37
Family Pre-protein crosslinking domain of SecA 0.0000923
Further Details:      
 
Domain Number 4 Region: 630-767,827-900
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 8.37e-37
Family Helical scaffold and wing domains of SecA 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) orange1.1g002515m|PACid:18107440
Sequence length 913
Sequence
MRHFDVQIIGGAVLHDGSIAEMKTGEGKTLVSTLAAYLNALTGEGVHVVTVNDYLAQRDA
EWMERVHRFLGLSVGLIQRGMIPEERRSNYRCDITYTNNSELGFDYLRDNLAANSEQLVM
RWPKPFHFAIVDEVDSVLIDEGRNPLLISGEASKDVARYPVAAKVAELLVQGLHYTVELK
NNSVELTEEGIALAEMALETNDLWDENDPWARFVMNALKAKEFYRRDVQYIVRNGKALII
NELTGRVEEKRRWSEGIHQAVEAKEGLKIQADSVVVAQITYQSLFKLYPKLSGMTGTAKT
EEKEFLKMFQMPVIEVPTNLPNIRVDLPIQSFATARGKWEYARQEVESMFRLGRPVLVGS
TSVENSEYLSDLLKQQGIPHNVLNARPKYAAREAETVAQAGRKYAITISTNMAGRGTDII
LGGNPKMLAKKIIEDRLLLLLTREALNVEVDDKTSSPKVLSEIKLGSSSLALLAKAALLA
KYVGKAEGKSWTYQEAKSFFSESVEMSQSMNLKELQKLIDKQSAMYPLGPTVALTYLSVL
KDCEVHCSNEGSEVKRLGGLHVIGTSLHESRRIDNQLRGRAGRQGDPGSTRFMVSLQDEM
FQKFSFDTSWAVDLISRITNDEDMPIEGDAIVRQLLGLQISAEKYYFGIRKSLVEFDEVL
EVQRKHVYDLRQSILTGANESCSQQIFQYMQAVVDEIIFGNVDPLKHPRYWSLDKLLKEF
IAIAGKILDDLFAGISGDTLLKSIEELPELNSIDINNFYFPDLPKPPNLFRGIRRKSSSL
KRWLAICSDDLTKNGRYRATTNLLRKYLGDILIASYLNVVQESRYDDVYMKEVERAVLVK
TLDCFWRDHLINMNRLSSAVNVRSFGHRNPLEEYKIDGCRFFISMLSATRRLTVESLVQY
WSSPMESQELFLS
Download sequence
Identical sequences A0A067GP73
orange1.1g002515m|PACid:18107440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]