SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g007317m|PACid:18126338 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g007317m|PACid:18126338
Domain Number 1 Region: 167-266
Classification Level Classification E-value
Superfamily POZ domain 1.49e-16
Family BTB/POZ domain 0.0049
Further Details:      
 
Domain Number 2 Region: 337-472
Classification Level Classification E-value
Superfamily POZ domain 2.04e-16
Family BTB/POZ domain 0.01
Further Details:      
 
Domain Number 3 Region: 39-116
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000352
Family Ankyrin repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) orange1.1g007317m|PACid:18126338
Sequence length 608
Sequence
MPSNRQSTIDAELDEIDLDASDFSSSVPLKKVPNGDVFEASRAGDVDRLRYILESGVNVN
ARDQWDSVALYYACLAGHLDAARMLLESGAICSEHTFDGDRCHYAALNLKVRKLLKAYEA
RPPPLGPLQAALRDTFLGCGANRQFLEEAEVVLGISGVTSNGASNSDSFPPDVVFYVQGR
PIEAHRVILSARSVFFRRKFETDWRYRNEIRFSREKLSYPALYGLIHFFYSDRLEIAVDD
MEDLVKICKVCKCESLQRIIEKELIHQKYAEYKALRDVDNSQKRFILQGSALPEEDRLPA
ALSRILQISLARSNMDHNIDNGICKLSSSVEAMHISDHVDDLADVCVRVDKKIFRCHQVV
LASRSEYFKARLSRMKDFYEGKEGLPGDILPCIEEHDLSKETFEKMIEYMYTDGLKDIDP
DQVCCNSVTWLVALGSNLPNFVPFDEQAEEMFDAASRYLLFPLKRAVADVLLLHLEMVSP
AELCHWLILSDMYGVFKVREYCLEVIACNFETFADSREFRAMLLTLPPPSGDSSFRTTVP
SAPGAIINVDQGNLLDDLREKWLEAEAAELDKRDESALMFDKRLEMLMQVAKDEKSEPIP
VDGEDHQT
Download sequence
Identical sequences A0A067F4R1
orange1.1g007317m|PACid:18126338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]