SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g007758m|PACid:18117840 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g007758m|PACid:18117840
Domain Number 1 Region: 241-350
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.35e-17
Family Ankyrin repeat 0.0015
Further Details:      
 
Domain Number 2 Region: 40-113,169-198
Classification Level Classification E-value
Superfamily POZ domain 0.00000000136
Family BTB/POZ domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) orange1.1g007758m|PACid:18117840
Sequence length 590
Sequence
METANEKSASLSFLSSYPTCWSTNQSTGPEICSDPGEPWLDAEIVVEGKSVVVNRSILSE
RSQFFHRLFNLRNDGSVSEGKPKYLLTDLVPHGKVGFEAFNDILLYLYTGMTKESPPEVS
ACVDDACVHVSCPPTINYAVELIYACAAFQITELVSYFQCLLLILAENAPVEDVIPILVA
ALHCQLNRLHSCCIQRIARSNLDNVCLEKELPDEVSSEIKSLRVKSNQESEANIKEVDPM
HEKRVRRIHKALDSDDFELLNLLLNEYEVTLDDAFALHYAAAYCNPKVFKEVLNMGLADL
NLKDARGRTVLHVAARRKEPAVLETLLSKGACASETTSDGRTAVAICRRMTRRKDYIEAS
KQGQETNKDWLCIAFLEREIRRNSMSGNLAMSADVMGDAFQMKLDYLEKKVAGVWLFPSE
AREAMEIAGADTATGLSALGRKGLSGNLKEIDLNETPSMQAKRRQLRLLTLLKTVETAHL
YFPHCSQVVEMFMDIDSPHCLEMVNEFLDCDWSDASLLEKVSPEERKLERAGFMKLRVDI
HEALCKDVAYHRHSRSAFYKYMAEDNRLAFYKYMAEGNRSGMSTSSASSN
Download sequence
Identical sequences A0A067DGX6
orange1.1g007758m|PACid:18117840 XP_015387737.1.29302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]