SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g010793m|PACid:18138819 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g010793m|PACid:18138819
Domain Number 1 Region: 61-188
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000785
Family BTB/POZ domain 0.021
Further Details:      
 
Domain Number 2 Region: 260-373
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000834
Family Ankyrin repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) orange1.1g010793m|PACid:18138819
Sequence length 501
Sequence
MANSIEPSSSLSFTSSSHLSNGSISHNQSSFSAPEKGVNLEVFSLNKLSSSLEQLLIDST
CEYSDAEIIVEGIPVCVHRCILAARSKFFYELFKREKGSVDKEGKPKYPMSELLPYGKVG
YEAFLIFLSYTYSGKLKPFPMEVSTCVDNICVHDACRPAINFAVEMMYASSIFELPELVS
LFQRRLLNFVGKAVAEDIIPILLAAFHCQLSQLLAQCVDRIVRSDLDTISIEKELPTEVA
EEIRMLRLKSFPDDENTAVEVDPLREKRIKRIHKALDSDDVELVRLLLSESEITLDEANA
LHYAAAYCDPKVLSEVLSLGLADVNLRSSRGYTVLHIGAMRKEPSVIVSLLTKGACASDL
TLDGRSAVSICRRLTRPKDYQAKTEQGKETNKDRICIDVLEGEMRRNPMAGDAFITSHTL
SDDLHMKLLYLENRVAFARLLFPTEAKLAMDIANTETTSEFSGFCASKGSSGNLREVDLN
ETPVMRNKRLRPRMEALMKTD
Download sequence
Identical sequences A0A067GFK3
orange1.1g010793m|PACid:18138819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]