SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g014994m|PACid:18117838 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g014994m|PACid:18117838
Domain Number 1 Region: 208-311
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.39e-17
Family Ankyrin repeat 0.0019
Further Details:      
 
Weak hits

Sequence:  orange1.1g014994m|PACid:18117838
Domain Number - Region: 56-74,130-157
Classification Level Classification E-value
Superfamily POZ domain 0.00513
Family Tetramerization domain of potassium channels 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) orange1.1g014994m|PACid:18117838
Sequence length 415
Sequence
MLRLLLRANQWRLIAAYCLSAVKFFRRLLNLRNDGSVSEGKPKYLLTDLVPCDGKFGFEA
FNDILHYIYTGKLKAPPPEVSACVDDACVHVSCPSSVNYVIELMYASAALQMKDRVFLLQ
HWLLGMVGKALVEDVLPILVAAFHCQLNMLRSYCIQRIAGSNLDNFCLERELPDEVSSEI
KSLRVKSNQESEANIAEVDPMHAKIVRRIHKALHSDDVELLKLLLDVSNVTLDDAYALHY
AAACCSPKVFKEVLNMDSAGLNLKDARGRTVLHVAARRNEPEVMVTLLSKGARASETTSD
GQTAVAICRRMTRRKDYIEASKQGQETNKDRLCIDVLEREMRRNSMSRFPPKKFLDCDWS
DAYLLENGTPEEQNRKRARFMELKEVQKAFYKDMAEKIVQVCRHPRRRHLLQRKE
Download sequence
Identical sequences A0A067DP69
orange1.1g014994m|PACid:18117838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]