SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g015565m|PACid:18113819 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  orange1.1g015565m|PACid:18113819
Domain Number - Region: 365-395
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0129
Family Rho termination factor, N-terminal domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) orange1.1g015565m|PACid:18113819
Sequence length 404
Sequence
MGNFTVSLSSYGPSEGRCLPCMGVSGRAVAVSSCSSRGDFRILSQVKIGAVKYSSKGASF
ACRASSGSYRRNPDFSRQNRNGYRGRNRQNEERDSIDDESELLSSRNGPILSLSNSPKFQ
ATSTPGPREKEIVELFRKVQVQLRERAAAREDKKTESMQGQRKESETVDSLLKLLRKHSV
EQGKRKSSSGSSNDFSLEQDEPNGSHIEDKSTSFFDSSSRARTESREPNVSSFTRPASNF
RRRSPVTQFKYQPVYSSEETENSISRLDSSGKGKKSSLEIHTDPKRESESEPELETEPEA
SFADGEVYDEASDVESNVITDGSLYDEVLENEPNIIDDSVYRVSEEGESSDNDEDENKQE
EIENGDLSALKLPELRALAKSRGVKGFSKMKKAVLLELLAGSSV
Download sequence
Identical sequences A0A067FAH3
orange1.1g015565m|PACid:18113819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]