SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g025681m|PACid:18112177 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g025681m|PACid:18112177
Domain Number 1 Region: 212-247
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000432
Family Rho termination factor, N-terminal domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) orange1.1g025681m|PACid:18112177
Sequence length 249
Sequence
MDATSFYPQPMLSLNKQLKPGTPVLSLRAIADWPSPFGIQKSPFKFTYLSIRADGSRGDR
PPLNGYAAGRTKNGDGNESSQSSDGKVSSSSNNEAIISLFGRIKSSISKREAIRTKKRNP
SSSDKPKVQSVPDVLLQPRKEVKVTDTHSMKDVPKEEQKIQNNEPVTDTKLTRLPSNFVK
RSPIPSPSAPRDKRVLNYEPSANKESTRQLELPRVEELKLPQLKELAKARGIKGYSRMKK
SELIKKLRS
Download sequence
Identical sequences A0A067GR32
orange1.1g025681m|PACid:18112177 XP_006467623.1.29302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]