SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g026184m|PACid:18103878 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g026184m|PACid:18103878
Domain Number 1 Region: 11-126
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 2.49e-17
Family N-utilization substance G protein NusG, N-terminal domain 0.0019
Further Details:      
 
Domain Number 2 Region: 189-237
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.00000000662
Family N-utilization substance G protein NusG, C-terminal domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) orange1.1g026184m|PACid:18103878
Sequence length 242
Sequence
MNLDTLADLGPRWWIVRVTRIRYEETAERLARSLARNFPDIDFKMYAPSVQVKKKLKNGS
YSDKPKPIFPGCVFLRCVLNKERHDFIRECDGVGGFVGSKVGNRIKQINKPRPVSVDDME
AIFKEAKEAQEQADQAFVEEQQREGTIKSENLNVESNTVTTVVTESFRDSKPKSQSGKAS
AKGNKLPAPGSTVRVVSGTFAEFLGTLKKVNRKTRKATVGFTLFGKESLVDLDLSEIVPE
TN
Download sequence
Identical sequences A0A067F485
orange1.1g026184m|PACid:18103878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]