SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for orange1.1g035516m|PACid:18124941 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g035516m|PACid:18124941
Domain Number 1 Region: 9-145
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000345
Family BTB/POZ domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) orange1.1g035516m|PACid:18124941
Sequence length 167
Sequence
MAAGKPTSKGQAWFCTTGLPSDIVIEVDEMSFHLHKFPLMSKSRKLHQLITEQENKPTMA
WKQEKETEIEEEEGEEEEEATCHISIPEDFPGGSETFEMVAKFCYGVKMELSSSNVAPLR
CAGEYLEMTEEFAEDNLISKTERFLSQSVFKSLKDSIRALKSCENVV
Download sequence
Identical sequences A0A067GVQ9
orange1.1g035516m|PACid:18124941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]