SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g046955m|PACid:18111064 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g046955m|PACid:18111064
Domain Number 1 Region: 200-314
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.88e-17
Family Ankyrin repeat 0.0022
Further Details:      
 
Weak hits

Sequence:  orange1.1g046955m|PACid:18111064
Domain Number - Region: 39-69,98-160
Classification Level Classification E-value
Superfamily POZ domain 0.0942
Family BTB/POZ domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) orange1.1g046955m|PACid:18111064
Sequence length 548
Sequence
METAKEKSASLSFLSSYPTCSSNNRPISPEICSDPEEPWLDAEIVVEGKSVAVNRSILSE
RSYLMSLNIGPSAFRFDKHGTDFPPHYYFPAQIIPFKYLNFEYIILNQNSICPCSILYVL
YYLWLLEVVEKALVEDVIPILMAALHCQLNQLRSYWIQRIARSNLDNVCLEKELPDEVSS
EIKSLRVKYNQESEANIAEVNPINAKVVRGIHRALDSGDVELLKLLLDVSNVTLDDAYTL
HYAAAYCNPMVFKEVLNMGSAGLNLKDARGRTVLHVAARHKEPAVMVALLSKGAWASETT
SDGQTALAISTKQGQETNKDRLCIDVLEREMRRNSMSGNLAMSAEVMDDDFQRKLDYMEN
IVACVRLFPSEARVAMEIAGADTTTGLSALGRKGLSGNLKEVDLNETPKEVDLNETPSMQ
AKRCQLRLLALLKTVETGQRYFPNCSEVVEKFMFFKFMFFNPANCSELVDEFLDCDSSDA
SLLEKGTPEVQKLQRACFMKLKVEMPEAFCKDVAYQRRSGLPSSWSAFYKYMAESNRSDM
PASSASSN
Download sequence
Identical sequences orange1.1g046955m|PACid:18111064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]