SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g000693m|PACid:18106935 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g000693m|PACid:18106935
Domain Number 1 Region: 496-713
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000146
Family Tropomyosin 0.001
Further Details:      
 
Domain Number 2 Region: 684-942
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000275
Family Tropomyosin 0.0013
Further Details:      
 
Weak hits

Sequence:  orange1.1g000693m|PACid:18106935
Domain Number - Region: 957-1159
Classification Level Classification E-value
Superfamily Tropomyosin 0.00024
Family Tropomyosin 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) orange1.1g000693m|PACid:18106935
Sequence length 1349
Sequence
MEEETQVGSEVPVMKAVEDIDPIKETNGGLPQVGKEGKKEEEENALDAEFIKVEKEALDV
KEVSHMAEPAAAEEDDKPSVVDRSSSSSSRELLEANEKVKELEIELERAATALKNAEIEN
ARLQDDVLITKEKLEESGKKCEELEIGQKKFQEQIVEAGEKYNSELNAMKEALQAEEAKR
KELAEVKEAFDGLSLEIEQSRSRLQELEHKLQCSVDEARKFEELHKQSGSHAESESQRAL
EFERLLETANVSAKEVEGQMASLQEELKGLNEKISEKEKVEEELKRSNTEISAIQEELGL
SKLQLLDLEQRFSSKEALITNLTQELDLIKASESQAKEEISALDNLLADAKENLHAKVSE
LEDIKLKLQEEVNARESVEAVLKTQEAQVSNVNEELDKVSKEKEALEAAMADLTGNIARM
KELCSELEEKLRNSDENFCKTDSLLSQALANNAELELKLKSLEEQHNETGAAAATASQRN
LELEDIIRASNEAAEEAKSQLRELEPRFIAAEQRSVELEQQLNLVELKSSDSEREVREFS
EKLSQLSTALKEVEEEKKQLHDQMNDYKDKITQLELILNQSNTRSSELEEELRITKERSA
EDEDRANMSHQRSIELEDLFQTSHSKLEGTGKRVNELELLLEAEKYRIQELEEQISKLEK
KCEEAEAGSKQYSDKVCELASELEAFQARTSSLEVALQMANDKERELTESLNAAADEKRK
LQDTSNGYNEKLAEAENLLELLRNDLNMTQERLESIEKDLKAAGLRETDVMEKLKSAEEQ
LEQQTRVLEQATSRNSELESLHESLMRESEMKLQDALANITSRDSEAKSFSEKLKNLEGQ
VKMYEEQLAEAAGKYALLKEELDSYFIKVTSLESTNEELQRQVVEANNKANNSSSENELL
VETNNQLKSKVAELQELLDSAISEKEATGQQLASHMNTVTELTEQHSRALELHSATEARV
KEAEIQLHEAIQRFTQRDIEANNLNEKVSVLEGQIKSYEEQAREASTVAETRKFELEETL
LKLKNLESTVEELQTRSGHFERESGGLVETNLKLTEDLALYETKLSDLQAKLSATIVEKD
ETVEQLHASKKAIEDLTQKLTSEVQGLQTQLEAQLNEKKATEETFKSEIESLKAQAAEKF
ALETRIKELEELLVNVETQFKEEVENVKVSAAGKEAELNSKLEDHAHEVKDRNALYEQVI
QLQRELQIAQTAIAEQRGADSQKDSEREAALKSSLEELGAKNKEAALLQNKVAELEQKLQ
QAQAKLKQGGEDTPSEVKDAAEIKSRDIGSVISTPSKRKSKKLEAAAQTSSTREIPTARA
DASPVMTFKFIIGVALVSVIIGITLGKRY
Download sequence
Identical sequences A0A067FME0
orange1.1g000693m|PACid:18106935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]