SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g001248m|PACid:18115113 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g001248m|PACid:18115113
Domain Number 1 Region: 422-659,817-935
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.98e-42
Family Quinoprotein alcohol dehydrogenase-like 0.038
Further Details:      
 
Domain Number 2 Region: 958-1092
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0000000942
Family Quinohemoprotein amine dehydrogenase B chain 0.055
Further Details:      
 
Weak hits

Sequence:  orange1.1g001248m|PACid:18115113
Domain Number - Region: 349-453
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 0.00165
Family Nitrous oxide reductase, N-terminal domain 0.036
Further Details:      
 
Domain Number - Region: 83-136
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0271
Family cAMP-binding domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) orange1.1g001248m|PACid:18115113
Sequence length 1114
Sequence
MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDDVEKYLSGF
TKVDDNRYSMKIFFEIRKQKYLEALDKHDRAKAVEILVKDLKVFSTFNEELFKEITQLLT
LENFRENEQLSKYGDTKSARSIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN
WQHQLCKNPRPNPDIKTLFVDHTCGQPNGARAPSPANNPLLGSLPKAGVFPPLGAHGPFQ
PTPAPVPTPLAGWMSNPPTVTHPAVSGGAIGLGSPSIPAAALKHPRTPPTNPSVDYPSGD
SDHLSKRTRPIGISDEINLPVNVLPVSFTGHSHSHSHSQAFSTPEDLPKTVTRTLNQGSS
PMSMDFHPVQQTLLLVGTNVGDIGLWEVGSRERLVLRNFKVWDLGACSMPLQAALVKDPG
VSVNRVIWSPDGSLFGVAYSRHIVQIYSYHGGDEVRQHLEIDAHVGGVNDIAFSHPNKQL
CVITCGDDKTIKVWDATNGAKQYIFEGHEAPVYSVCPHHKENIQFIFSTALDGKIKAWLY
DNLGSRVDYEAPGRWCTTMAYSADGTRTYQGFRKRSLGVVQFDTTKNRFLAAGDDFSIKF
WDMDSVQLLTSIDADGGLPASPRIRFNKDGCLLAVSTNDNGIKILATSDGIRLLRTFENL
AYDASRTSENSKPTISPISAAAAAAATSAGLADRAASMVSIPGMNGDVRSLADVKPRITE
ESNDKSKVWKLTELSEPNQCRSLRLPENLRATKISRLIFTNSGNAILALASNAIHLLWKW
QRTERNSSGKATASVAPQLWQPPSGIMMTNDVTDSNPEEAVPCFALSKNDSYVMSASGGK
ISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNIIAIGMDDSSIQIYNVRVDEVKSKLKG
HSKRITGLAFSHALNVLVSSGADSQLCVWSSDGWEKQKNRFLQIPTGRTPTAQSDTRVQF
HQDQIHFLVVHETQLAIFETTKLECVKQWVPRESSAPITHATFSCDSQLVYACFLDATVC
VFSAANLKLRCRINPSAYLPAGVSSSNVHPLVIAAHPQEPNEFALGLSDGGVHVFEPLES
EGKWGVPPPVDNGSTSSMPATPPVGGSGSDQAQR
Download sequence
Identical sequences orange1.1g001248m|PACid:18115113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]